MKRN1 Rabbit Polyclonal Antibody

CAT#: TA329834

Rabbit Polyclonal Anti-MKRN1 Antibody

Product Images

WB Suggested Anti-MKRN1 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MKRN1 antibody: synthetic peptide directed towards the C terminal of human MKRN1. Synthetic peptide located within the following region: RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: makorin ring finger protein 1
• Database Link:
  NP_001138597
  Entrez Gene 23608 Human
  UniProt ID Q9UHC7
• Background: The Makorin ring finger protein-1 (MKRN1) is a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.
• Synonyms: RNF61
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome