Rabbit Polyclonal Anti-MKRN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKRN2 antibody: synthetic peptide directed towards the N terminal of human MKRN2. Synthetic peptide located within the following region: STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC |
Rabbit Polyclonal Anti-MKRN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKRN2 antibody: synthetic peptide directed towards the C terminal of human MKRN2. Synthetic peptide located within the following region: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS |
MKRN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human MKRN2 (NP_054879.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China