MKRN2 Rabbit Polyclonal Antibody

CAT#: TA329836

Rabbit Polyclonal Anti-MKRN2 Antibody

Product Images

WB Suggested Anti-MKRN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MKRN2 antibody: synthetic peptide directed towards the C terminal of human MKRN2. Synthetic peptide located within the following region: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: makorin ring finger protein 2
• Database Link:
  NP_054879
  Entrez Gene 23609 Human
  UniProt ID Q9H000
• Background: Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2778 BC015715.1 24-2801
• Synonyms: HSPC070; RNF62
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome