MLX interacting protein (MLXIP) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human MLXIP |
MLX interacting protein (MLXIP) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human MLXIP |
Rabbit Polyclonal Anti-MLXIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the middle region of human MLXIP. Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP |
Rabbit Polyclonal Anti-MLXIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the C terminal of human MLXIP. Synthetic peptide located within the following region: ALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIG |
Rabbit Polyclonal Anti-MLXIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | MLXIP antibody was raised against a peptide corresponding to 19 amino acids near the amino terminus of human MLXIP. |
MLXIP Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MLXIP (NP_055753.3). |
Modifications | Unmodified |