MLX interacting protein (MLXIP) Rabbit Polyclonal Antibody

CAT#: TA339476

Rabbit Polyclonal Anti-MLXIP Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Other products for "MLXIP"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the middle region of human MLXIP. Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 101 kDa
Gene Name MLX interacting protein
Background This gene encodes a protein that functions as part of a heterodimer to activate transcription. The encoded protein forms a heterodimer with Max-like protein X (MLX) and is involved in the regulation of genes in response to cellular glucose levels. [provided by RefSeq, Mar 2014]
Synonyms bHLHe36; MIR; MONDOA
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 86%; Mouse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.