Antibodies

Jump to Filters
View as table Download
MOV10 (N-term) Rabbit Polyclonal Antibody
AP52733PU-N

USD 450.00

2 Weeks

MOV10 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 259-288aa) of human MOV10
MOV10 Rabbit Polyclonal Antibody
TA341614

USD 310.00

5 Days

Rabbit Polyclonal Anti-MOV10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOV10 antibody: synthetic peptide directed towards the C terminal of human MOV10. Synthetic peptide located within the following region: AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
MOV10 Rabbit Polyclonal Antibody
TA378607

USD 220.00

3 Weeks

MOV10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human MOV10 (NP_066014.1).
Modifications Unmodified