MOV10 Rabbit Polyclonal Antibody

CAT#: TA341614

Rabbit Polyclonal Anti-MOV10 Antibody

Product Images

WB Suggested Anti-MOV10 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MOV10 antibody: synthetic peptide directed towards the C terminal of human MOV10. Synthetic peptide located within the following region: AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: Mov10 RISC complex RNA helicase
• Database Link:
  NP_066014
  Entrez Gene 4343 Human
  UniProt ID Q9HCE1
• Background: MOV10 may be an helicase with an important function in development and/or control of cell proliferation.
• Synonyms: fSAP113; gb110
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 86%