Germany
Japan
United Kingdom
China
Rabbit Polyclonal MRPL41 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MRPL41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPL41 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL41. Synthetic peptide located within the following region: ESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQ |
MRPL41 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human MRPL41 (NP_115866.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MRPL41