MRPL41 Rabbit Polyclonal Antibody

CAT#: TA331271

Rabbit Polyclonal Anti-MRPL41 Antibody

Product Images

WB Suggested Anti-MRPL41 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole CellMRPL41 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MRPL41 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL41. Synthetic peptide located within the following region: ESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: mitochondrial ribosomal protein L41
• Database Link:
  NP_115866
  Entrez Gene 64975 Human
  UniProt ID Q8IXM3
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the YmL27 ribosomal protein family.
• Synonyms: BMRP; MRP-L27; MRPL27; PIG3; RPML27
• Note: Human: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Bovine: 79%