Antibodies

Jump to Filters
View as table Download
MRPL52 Rabbit Polyclonal Antibody
TA316061

USD 345.00

4 Weeks

Rabbit polyclonal anti-MRPL52 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRPL52.
MRPL52 Rabbit Polyclonal Antibody
TA337438

USD 375.00

5 Days

Rabbit Polyclonal Anti-MRPL52 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MRPL52 antibody is: synthetic peptide directed towards the N-terminal region of Human MRPL52. Synthetic peptide located within the following region: MKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENAL