MRPL52 Rabbit Polyclonal Antibody

CAT#: TA337438

Rabbit Polyclonal Anti-MRPL52 Antibody

Product Images

Host: Rabbit; Target Name: MRPL52; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MRPL52 antibody is: synthetic peptide directed towards the N-terminal region of Human MRPL52. Synthetic peptide located within the following region: MKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 7 kDa
• Gene Name: mitochondrial ribosomal protein L52
• Database Link:
  NP_848026
  Entrez Gene 122704 Human
  UniProt ID Q86TS9
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis.
• Synonyms: mitochondrial ribosomal protein L52; OTTHUMP00000164489
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 91%; Mouse: 91%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%