Antibodies

Jump to Filters
View as table Download
MRPS12 Rabbit Polyclonal Antibody
TA314474

USD 345.00

In Stock

Rabbit polyclonal anti-MRPS12 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRPS12.
MRPS12 (Center) Rabbit Polyclonal Antibody
AP52751PU-N

USD 450.00

2 Weeks

MRPS12 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 35-67 amino acids from the Central region of Human MRPS12
MRPS12 Rabbit Polyclonal Antibody
TA339353

USD 375.00

5 Days

Rabbit Polyclonal Anti-MRPS12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRPS12 antibody: synthetic peptide directed towards the N terminal of human MRPS12. Synthetic peptide located within the following region: LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK
MRPS12 Rabbit Polyclonal Antibody
TA378667

USD 220.00

3 Weeks

MRPS12 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-138 of human MRPS12 (NP_203527.1).
Modifications Unmodified