Antibodies

View as table Download

Rabbit polyclonal anti-MRPS16 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRPS16.

Rabbit Polyclonal Anti-MRPS16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MRPS16 Antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS16. Synthetic peptide located within the following region: EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

MRPS16 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human MRPS16 (NP_057149.1).
Modifications Unmodified