Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-MRPS5 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRPS5. |
Rabbit Polyclonal Anti-MRPS5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS5 antibody is: synthetic peptide directed towards the N-terminal region of Human MRPS5. Synthetic peptide located within the following region: ETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAV |
Rabbit Polyclonal Anti-MRPS5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS5 antibody is: synthetic peptide directed towards the N-terminal region of Human MRPS5. Synthetic peptide located within the following region: KRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEAD |
MRPS5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MRPS5 |
Active filters
Target Symbol
- MRPS5