Antibodies

View as table Download

Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

MS4A4A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 40-68 amino acids from the N-terminal region of Human MS4A4A

Ms4a4a Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human Ms4a4a.

Recombinant Anti-MS4A4A (Clone 5C12)

Applications FC, IP
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-MS4A4A (Clone 5C12)

Applications FC, IP
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-MS4A4A (Clone 3F2)

Applications FC, IP
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-MS4A4A (Clone 3F2)

Applications FC, IP
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.