Rabbit Polyclonal Anti-MSL3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the N terminal of human MSL3L1. Synthetic peptide located within the following region: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIP |
Rabbit Polyclonal Anti-MSL3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the C terminal of human MSL3L1. Synthetic peptide located within the following region: FSEKNLKALLKHFDLFLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY |
Rabbit Polyclonal Anti-MSL3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the middle region of human MSL3L1. Synthetic peptide located within the following region: SSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPK |
MSL3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MSL3 |
MSL3 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MSL3 |
Germany
Japan
United Kingdom
China