MSL3L1 (MSL3) Rabbit Polyclonal Antibody

CAT#: TA345488

Rabbit Polyclonal Anti-MSL3L1 Antibody

Product Images

WB Suggested Anti-MSL3L1 Antibody Titration: 0.625 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the C terminal of human MSL3L1. Synthetic peptide located within the following region: FSEKNLKALLKHFDLFLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: male-specific lethal 3 homolog (Drosophila)
• Database Link:
  NP_006791
  Entrez Gene 10943 Human
  UniProt ID Q8N5Y2
• Background: MSL3L1 is a nuclear protein, which is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation.
• Synonyms: MSL3L1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors