Carrier-free (BSA/glycerol-free) MSRB3 mouse monoclonal antibody, clone OTI6F9 (formerly 6F9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MSRB3 mouse monoclonal antibody, clone OTI6F9 (formerly 6F9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MSRB3 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSRB3 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA |
MSRB3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human MSRB3 (NP_001026849.1). |
Modifications | Unmodified |
MSRB3 mouse monoclonal antibody, clone OTI6F9 (formerly 6F9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSRB3 mouse monoclonal antibody,clone 6F9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MSRB3 mouse monoclonal antibody,clone 6F9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MSRB3 mouse monoclonal antibody, clone OTI6F9 (formerly 6F9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSRB3 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSRB3 mouse monoclonal antibody,clone 2A2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MSRB3 mouse monoclonal antibody,clone 2A2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MSRB3 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |