B MyB (MYBL2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
B MyB (MYBL2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MYBL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK |
Goat Polyclonal Antibody against MYBL2
Applications | WB |
Reactivities | Rat |
Immunogen | Peptide with sequence C-QEKARQLLGRLKPSH, from the C Terminus of the protein sequence according to NP_002457.1. |