Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MYBPC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBPC2 antibody: synthetic peptide directed towards the N terminal of human MYBPC2. Synthetic peptide located within the following region: KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT |
MYBPC2 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | MYBPC2 antibody was raised against synthetic peptide - KLH conjugated |
Carrier-free (BSA/glycerol-free) MYBPC2 mouse monoclonal antibody,clone OTI2E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MYBPC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 912-1141 of human MYBPC2 (NP_004524.3). |
| Modifications | Unmodified |
MYBPC2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 912-1141 of human MYBPC2 (NP_004524.3). |
| Modifications | Unmodified |
MYBPC2 mouse monoclonal antibody,clone OTI2E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MYBPC2 mouse monoclonal antibody,clone OTI2E1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MYBPC2 mouse monoclonal antibody,clone OTI2E1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MYBPC2 mouse monoclonal antibody,clone OTI2E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MYBPC2