Rabbit Polyclonal Anti-N4BP2L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-N4BP2L1 antibody is: synthetic peptide directed towards the C-terminal region of Human N4BP2L1. Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW |
Rabbit Polyclonal Anti-N4BP2L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-N4BP2L1 antibody is: synthetic peptide directed towards the N-terminal region of Human N4BP2L1. Synthetic peptide located within the following region: QLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNG |
N4BP2L1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human N4BP2L1 (NP_001073159). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China