N42L1 (N4BP2L1) Rabbit Polyclonal Antibody

CAT#: TA337455

Rabbit Polyclonal Anti-N4BP2L1 Antibody

Product Images

Host: Rabbit; Target Name: N4BP2L1; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-N4BP2L1 antibody is: synthetic peptide directed towards the N-terminal region of Human N4BP2L1. Synthetic peptide located within the following region: QLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: NEDD4 binding protein 2-like 1
• Database Link:
  NP_438169
  Entrez Gene 90634 Human
  UniProt ID Q5TBK1
• Background: The function of this protein remains unknown.
• Synonyms: CG018
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Dog: 75%; Zebrafish: 75%