Rabbit Polyclonal Anti-N6AMT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-N6AMT1 antibody: synthetic peptide directed towards the N terminal of human N6AMT1. Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL |
N6AMT1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human N6AMT1 |
N6AMT1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human N6AMT1 (NP_877426.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
