HEMK2 (N6AMT1) Rabbit Polyclonal Antibody

CAT#: TA338930

Rabbit Polyclonal Anti-N6AMT1 Antibody

Product Images

WB Suggested Anti-N6AMT1 Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: Mouse Brain lysate

• 

  WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate.N6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-N6AMT1 antibody: synthetic peptide directed towards the N terminal of human N6AMT1. Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: N-6 adenine-specific DNA methyltransferase 1 (putative)
• Database Link:
  NP_877426
  Entrez Gene 67768 MouseEntrez Gene 29104 Human
  UniProt ID Q9Y5N5
• Background: This gene encodes an N(6)-adenine-specific DNA methyltransferase. The encoded enzyme may be involved in the methylation of release factor I during translation termination. This enzyme is also involved in converting the arsenic metabolite monomethylarsonous acid to the less toxic dimethylarsonic acid. Alternative splicing pf this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 11. [provided by RefSeq, Jul 2014]
• Synonyms: C21orf127; HEMK2; m.HsaHemK2P; MTQ2; N6AMT; PRED28
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Pig: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome