Antibodies

View as table Download

Rabbit Polyclonal antibody to NCS1 (neuronal calcium sensor 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 138 of NCS1

Rabbit Polyclonal Anti-NCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FREQ Antibody: synthetic peptide directed towards the N terminal of human FREQ. Synthetic peptide located within the following region: MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK

Rabbit polyclonal Frequenin antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Frequenin (recombinant from Mouse with extensive post-translational modifications)

Rabbit Polyclonal Anti-FREQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FREQ antibody: synthetic peptide directed towards the middle region of human FREQ. Synthetic peptide located within the following region: EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL

NCS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NCS1

NCS1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human NCS1 (NP_055101.2).
Modifications Unmodified

NCS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human NCS1 (NP_055101.2).
Modifications Unmodified