NEMF rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NEMF |
NEMF rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NEMF |
Rabbit polyclonal anti-SDCG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SDCG1. |
Rabbit Polyclonal Anti-NEMF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NEMF Antibody is: synthetic peptide directed towards the C-terminal region of Human NEMF. Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP |
Carrier-free (BSA/glycerol-free) NEMF mouse monoclonal antibody,clone OTI7E10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NEMF Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NEMF |
NEMF mouse monoclonal antibody,clone OTI7E10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NEMF mouse monoclonal antibody,clone OTI7E10, Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NEMF mouse monoclonal antibody,clone OTI7E10, HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NEMF mouse monoclonal antibody,clone OTI7E10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |