Antibodies

View as table Download

NEMF rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEMF

Rabbit polyclonal anti-SDCG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SDCG1.

Rabbit Polyclonal Anti-NEMF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NEMF Antibody is: synthetic peptide directed towards the C-terminal region of Human NEMF. Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP

Carrier-free (BSA/glycerol-free) NEMF mouse monoclonal antibody,clone OTI7E10

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-NEMF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEMF

NEMF mouse monoclonal antibody,clone OTI7E10

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NEMF mouse monoclonal antibody,clone OTI7E10

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated