NEMF Rabbit Polyclonal Antibody

CAT#: TA332089

Rabbit Polyclonal Anti-NEMF Antibody

Product Images

Host: Rabbit; Target Name: NEMF; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NEMF Antibody is: synthetic peptide directed towards the C-terminal region of Human NEMF. Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: nuclear export mediator factor
• Database Link:
  NP_004704
  Entrez Gene 9147 Human
  UniProt ID O60524
• Background: NEMF plays a role in nuclear export.
• Synonyms: NY-CO-1; SDCCAG1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 85%