Antibodies

Jump to Filters
View as table Download
Nidogen 2 (NID2) Rabbit Polyclonal Antibody
TA346763

USD 475.00

5 Days

Rabbit Polyclonal Anti-NID2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NID2 antibody: synthetic peptide directed towards the middle region of human NID2. Synthetic peptide located within the following region: DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV
NID2 Rabbit Polyclonal Antibody
TA366079

USD 380.00

4 Weeks

NID2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NID2
NID2 Rabbit Polyclonal Antibody
TA370433

USD 380.00

4 Weeks

NID2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NID2