Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NKIRAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NKIRAS1 Antibody: synthetic peptide directed towards the N terminal of human NKIRAS1. Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV |
Carrier-free (BSA/glycerol-free) NKIRAS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NKIRAS1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
NKIRAS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
NKIRAS1 mouse monoclonal antibody,clone 8A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NKIRAS1 mouse monoclonal antibody,clone 8A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NKIRAS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- NKIRAS1