Rabbit Polyclonal Anti-CCRN4L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCRN4L antibody: synthetic peptide directed towards the N terminal of human CCRN4L. Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD |
Nocturnin (NOCT) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CCRN4L |
NOCT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 132-431 of human NOCT (NP_036250.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
