Nocturnin (NOCT) Rabbit Polyclonal Antibody

CAT#: TA330589

Rabbit Polyclonal Anti-CCRN4L Antibody

Product Images

WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0ug/ml; Positive Control: Daudi cell lysateCCRN4L is supported by BioGPS gene expression data to be expressed in Daudi

• 

  Human Lung

• 

  Rabbit Anti-CCRN4L antibody; Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCRN4L antibody: synthetic peptide directed towards the N terminal of human CCRN4L. Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: nocturnin
• Database Link:
  NP_036250
  Entrez Gene 25819 Human
  UniProt ID Q9UK39
• Background: CCRN4L is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector.
• Synonyms: Ccr4c; CCR4L; CCRN4L; NOC
• Note: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%