Antibodies

View as table Download

Rabbit Polyclonal Anti-NOL6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOL6 antibody: synthetic peptide directed towards the C terminal of human NOL6. Synthetic peptide located within the following region: VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG

Rabbit Polyclonal Anti-NOL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOL6 antibody: synthetic peptide directed towards the N terminal of human NOL6. Synthetic peptide located within the following region: SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR

NOL6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1032-1146 of human NOL6 (NP_075068.2).
Modifications Unmodified