NOL6 Rabbit Polyclonal Antibody

CAT#: TA343920

Rabbit Polyclonal Anti-NOL6 Antibody

Product Images

WB Suggested Anti-NOL6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysate; NOL6 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NOL6 antibody: synthetic peptide directed towards the N terminal of human NOL6. Synthetic peptide located within the following region: SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 127 kDa
• Gene Name: nucleolar protein 6
• Database Link:
  NP_075068
  Entrez Gene 65083 Human
  UniProt ID Q9H6R4
• Background: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.
• Synonyms: bA311H10.1; NRAP; UTP22
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Yeast: 90%

Reference Data

• Protein Families: Druggable Genome