Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NR2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV |
NR2F6 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 24-53 amino acids from the N-terminal region of human NR2F6 |
Rabbit Polyclonal Anti-NR2F6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
Rabbit Polyclonal Anti-NR2F6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
Rabbit Polyclonal Anti-NR2F6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR2F6 Antibody: synthetic peptide directed towards the middle region of human NR2F6. Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP |
Rabbit Polyclonal Anti-NR2F6 Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | EAR2 / NR2F6 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR2F6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Pig, Platypus, Xenopus, Stickleback, Pufferfish, Zebrafish (100%); Opossum (94%). |
Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NR2F6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human NR2F6 (NP_005225.2). |
| Modifications | Unmodified |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NR2F6