NR2F6 Rabbit Polyclonal Antibody

CAT#: TA338164

Rabbit Polyclonal Anti-NR2F6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NR2F6"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 43 kDa
Gene Name nuclear receptor subfamily 2 group F member 6
Background Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).
Synonyms EAR-2; EAR2; ERBAL2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.