Rabbit Polyclonal Anti-NRM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRM antibody: synthetic peptide directed towards the N terminal of human NRM. Synthetic peptide located within the following region: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW |
NRM Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NRM |
NRM Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NRM |
Germany
Japan
United Kingdom
China