Nurim (NRM) Rabbit Polyclonal Antibody

CAT#: TA341888

Rabbit Polyclonal Anti-NRM Antibody

Product Images

WB Suggested Anti-NRM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NRM antibody: synthetic peptide directed towards the N terminal of human NRM. Synthetic peptide located within the following region: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: nurim (nuclear envelope membrane protein)
• Database Link:
  NP_009174
  Entrez Gene 11270 Human
  UniProt ID Q8IXM6
• Background: The protein encoded byThis gene contains transmembrane domains and resides withinThe inner nuclear membrane, where it is tightly associated withThe nucleus.This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
• Synonyms: NRM29
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane