Antibodies

Jump to Filters
View as table Download
Nucleobindin 1 (NUCB1) Rabbit Polyclonal Antibody
TA330178

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB1 antibody: synthetic peptide directed towards the C terminal of human NUCB1. Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Nucleobindin 1 (NUCB1) Rabbit Polyclonal Antibody
TA330179

USD 310.00

5 Days

Rabbit Polyclonal Anti-NUCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB1 antibody: synthetic peptide directed towards the C terminal of human NUCB1. Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF503868

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUCB1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1A3]
CF503917

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUCB1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI2A5]
CF503930

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUCB1 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF504035

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NUCB1 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Rabbit Polyclonal Antibody
TA379386

USD 220.00

3 Weeks

NUCB1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 302-461 of human NUCB1 (NP_006175.2).
Modifications Unmodified
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
TA503868

USD 379.00

In Stock

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA503868AM

USD 420.00

4 Weeks

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A5]
TA503868BM

USD 420.00

4 Weeks

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
TA503868S

USD 159.00

In Stock

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1A3]
TA503917

USD 379.00

In Stock

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]
TA503917AM

USD 420.00

4 Weeks

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A3 (formerly 1A3), Biotinylated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]
TA503917BM

USD 420.00

4 Weeks

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A3 (formerly 1A3), HRP conjugated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1A3]
TA503917S

USD 159.00

2 Days

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI2A5]
TA503930

USD 379.00

In Stock

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA504035

USD 379.00

In Stock

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]
TA504035AM

USD 420.00

4 Weeks

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]
TA504035BM

USD 420.00

4 Weeks

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA504035S

USD 159.00

2 Days

NUCB1 (Nucleobindin 1) mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated