Rabbit Polyclonal Anti-NXF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NXF1 antibody: synthetic peptide directed towards the N terminal of human NXF1. Synthetic peptide located within the following region: MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS |
Rabbit Polyclonal Anti-NXF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NXF1 antibody: synthetic peptide directed towards the N terminal of human NXF1. Synthetic peptide located within the following region: RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG |
Rabbit Polyclonal Anti-NXF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NXF1 Antibody: A synthesized peptide derived from human NXF1 |
Rabbit polyclonal NXF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NXF1. |
NXF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 57-356 of human NXF1 (NP_001074960.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
