Rabbit Polyclonal Anti-BTBD14B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B. Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE |
Rabbit Polyclonal Anti-BTBD14B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the middle region of human BTBD14B. Synthetic peptide located within the following region: EGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL |
Goat Polyclonal Antibody against BTBD14B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTEQQESDSVQC, from the internal region of the protein sequence according to NP_443108.1. |
Rabbit Polyclonal Anti-NACC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the middle region of human BTBD14B. Synthetic peptide located within the following region: VVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQIC |
NACC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1). |
| Modifications | Unmodified |
NACC1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
