Rabbit Polyclonal Anti-NCOA2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCOA2 antibody: synthetic peptide directed towards the N terminal of human NCOA2. Synthetic peptide located within the following region: MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELA |
Rabbit polyclonal NCoA2 (Ser736) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NCoA2 around the phosphorylation site of serine 736 (P-V-SP-P-K). |
| Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) NCOA2 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCOA2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCOA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NCOA2 |
NCOA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NCOA2 |
NCOA2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 550-820 of human NCOA2 (NP_006531.1). |
| Modifications | Unmodified |
NCOA2 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA2 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCOA2 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCOA2 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NCOA2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NCOA2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NCOA2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
