Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NDRG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDRG4 antibody is: synthetic peptide directed towards the N-terminal region of Human NDRG4. Synthetic peptide located within the following region: EKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGN |
Rabbit Polyclonal Anti-NDRG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDRG4 antibody is: synthetic peptide directed towards the C-terminal region of Human NDRG4. Synthetic peptide located within the following region: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME |
NDRG4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NDRG4 |
NDRG4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human NDRG4 (NP_001229765.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NDRG4