Germany
Japan
United Kingdom
China
Anti-NET1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human neuroepithelial cell transforming 1 |
Antibodies
View as table Download
Goat Anti-NET1 / ARHGEF8 (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKLEYLDEKQRDPR, from the internal region of the protein sequence according to NP_005854.2; NP_001040625.1. |
Rabbit Polyclonal Anti-NET1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NET1 antibody: synthetic peptide directed towards the N terminal of human NET1. Synthetic peptide located within the following region: RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR |
Rabbit Polyclonal Anti-NET1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NET1 antibody: synthetic peptide directed towards the middle region of human NET1. Synthetic peptide located within the following region: AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHG |
Rabbit Polyclonal Anti-NET1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NET1 antibody was raised against synthetic 15 amino acid peptide from internal region of human NET1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan (100%); Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Rabbit, Opossum, Platypus (93%); Panda, Dog, Horse, Turkey, Chicken (87%); Pig (80%). |
Rabbit Polyclonal Anti-NET1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NET1 antibody was raised against synthetic 13 amino acid peptide from near C-terminus of human NET1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Orangutan, Marmoset (92%); Gibbon, Monkey (85%). |
NET1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human NET1 (NP_001040625.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NET1