NET1 Rabbit Polyclonal Antibody

CAT#: TA340085

Rabbit Polyclonal Anti-NET1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NET1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NET1 antibody: synthetic peptide directed towards the N terminal of human NET1. Synthetic peptide located within the following region: RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 62 kDa
Gene Name neuroepithelial cell transforming 1
Background NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.
Synonyms ARHGEF8; NET1A
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 92%; Guinea pig: 92%; Dog: 86%; Horse: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.