Rabbit Polyclonal Anti-NEUROD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4. Synthetic peptide located within the following region: PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT |
Rabbit Polyclonal Anti-NEUROD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4. Synthetic peptide located within the following region: GHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFS |
Carrier-free (BSA/glycerol-free) NEUROD4 mouse monoclonal antibody,clone OTI10H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NEUROD4 mouse monoclonal antibody,clone OTI10H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NEUROD4 mouse monoclonal antibody,clone OTI10H2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NEUROD4 mouse monoclonal antibody,clone OTI10H2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NEUROD4 mouse monoclonal antibody,clone OTI10H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
