NEUROD4 Rabbit Polyclonal Antibody

CAT#: TA345328

Rabbit Polyclonal Anti-NEUROD4 Antibody

Product Images

WB Suggested Anti-NEUROD4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4. Synthetic peptide located within the following region: PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: neuronal differentiation 4
• Database Link:
  NP_067014
  Entrez Gene 58158 Human
  UniProt ID Q9HD90
• Background: The specific function of the protein remains unknown.
• Synonyms: ATH-3; ATH3; Atoh3; bHLHa4; MATH-3; MATH3
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors