Antibodies

Jump to Filters
View as table Download
Nexilin (NEXN) Rabbit Polyclonal Antibody
TA346500

USD 475.00

5 Days

Rabbit Polyclonal Anti-NEXN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEXN antibody: synthetic peptide directed towards the middle region of human NEXN. Synthetic peptide located within the following region: EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI
Nexilin (NEXN) Rabbit Polyclonal Antibody
TA379068

USD 220.00

3 Weeks

NEXN Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 516-675 of human NEXN (NP_653174.3).
Modifications Unmodified