Nexilin (NEXN) Rabbit Polyclonal Antibody

CAT#: TA346500

Rabbit Polyclonal Anti-NEXN Antibody

Product Images

WB Suggested Anti-NEXN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NEXN antibody: synthetic peptide directed towards the middle region of human NEXN. Synthetic peptide located within the following region: EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: nexilin F-actin binding protein
• Database Link:
  NP_653174
  Entrez Gene 91624 Human
  UniProt ID Q0ZGT2
• Background: This gene encodes a filamentous actin-binding protein that may function in cell adhesion and migration. Mutations in this gene have been associated with dilated cardiomyopathy, also known as CMD1CC. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
• Synonyms: CMH20; NELIN
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome