Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NINJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NINJ1 antibody: synthetic peptide directed towards the N terminal of human NINJ1. Synthetic peptide located within the following region: DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM |
NINJ1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NINJ1 |
NINJ1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NINJ1 (NP_004139.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NINJ1