Rabbit Polyclonal KappaB ras Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KappaB ras antibody was raised against a 18 amino acid peptide from near the center of human KappaB ras 1. |
Rabbit Polyclonal KappaB ras Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KappaB ras antibody was raised against a 18 amino acid peptide from near the center of human KappaB ras 1. |
Rabbit Polyclonal KappaB ras1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KappaB ras1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human KappaB ras1. |
Rabbit Polyclonal Anti-NKIRAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NKIRAS1 Antibody: synthetic peptide directed towards the N terminal of human NKIRAS1. Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV |
Carrier-free (BSA/glycerol-free) NKIRAS1 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NKIRAS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NKIRAS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NKIRAS1 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NKIRAS1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1). |
Modifications | Unmodified |
NKIRAS1 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
NKIRAS1 mouse monoclonal antibody,clone 1D2, Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NKIRAS1 mouse monoclonal antibody,clone 1D2, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NKIRAS1 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NKIRAS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
NKIRAS1 mouse monoclonal antibody,clone 6C11, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NKIRAS1 mouse monoclonal antibody,clone 6C11, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NKIRAS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NKIRAS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
NKIRAS1 mouse monoclonal antibody,clone 8A3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NKIRAS1 mouse monoclonal antibody,clone 8A3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NKIRAS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NKIRAS1 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NKIRAS1 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NKIRAS1 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NKIRAS1 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |